SCOPe 2.05: Domain d4o95a1: 4o95 A:38-246

Lineage for d4o95a1 (4o95 A:38-246)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
   consists of two alpha+beta subdomains

4. Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families)

5. Family d.145.1.0: automated matches [191624] (1 protein)
   not a true family

6. Protein automated matches [191143] (7 species)
   not a true protein

7. Species Maize (Zea mays) [TaxId:4577] [225479] (14 PDB entries)

8. Domain d4o95a1: 4o95 A:38-246 [270986]
   Other proteins in same PDB: d4o95a2
   automated match to d1w1oa2
   complexed with 245, dms, edo, fad, gol, peg

Details for d4o95a1

PDB Entry: 4o95, 1.75 Å

PDB Description: crystal structure of maize cytokinin oxidase/dehydrogenase 4 (zmcko4) in complex with phenylurea inhibitor cppu

PDB Compounds: (A:) Cytokinin dehydrogenase 4

SCOPe Domain Sequences for d4o95a1:

Sequence; same for both SEQRES and ATOM records:

>d4o95a1 d.145.1.0 (A:38-246) automated matches {Maize (Zea mays) [TaxId: 4577]}
vgggrlsvdasdiaeasrdfggvaraepmavfhpraagdvaglvgaafrsargfrvsarg
hghsisgqaqaaggvvvdmsrgrgpgaavaralpvhsaalgghyvdvwggelwvdvlnwt
lshgglaprswtdylylsvggtlsnagisgqafhhgpqisnvyeldvvtgkgevvtcset
enpdlffgvlgglgqfgiitrarialera

Timeline for d4o95a1:

• d4o95a1 is new in SCOPe 2.05-stable
  
• d4o95a1 appears in SCOPe 2.06
  
• d4o95a1 appears in the current release, SCOPe 2.08