Lineage for d4oala2 (4oal A:247-531)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2562051Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (7 families) (S)
    duplication: contains two subdomains of this fold
  5. 2562158Family d.58.32.0: automated matches [227166] (1 protein)
    not a true family
  6. 2562159Protein automated matches [226875] (5 species)
    not a true protein
  7. 2562165Species Maize (Zea mays) [TaxId:4577] [269671] (10 PDB entries)
  8. 2562170Domain d4oala2: 4oal A:247-531 [270984]
    Other proteins in same PDB: d4oala1, d4oalb1
    automated match to d1w1oa1
    complexed with 245, dms, fad

Details for d4oala2

PDB Entry: 4oal (more details), 1.9 Å

PDB Description: crystal structure of maize cytokinin oxidase/dehydrogenase 4 (zmcko4) in complex with phenylurea inhibitor cppu in alternative spacegroup
PDB Compounds: (A:) Cytokinin dehydrogenase 4

SCOPe Domain Sequences for d4oala2:

Sequence, based on SEQRES records: (download)

>d4oala2 d.58.32.0 (A:247-531) automated matches {Maize (Zea mays) [TaxId: 4577]}
pkrvrwiralysnfseftadqerlislgsgggrrfdyvegfvvaaeglinnwrssffspq
npvkltslkhhssvlyclevtknyddetagsvdqdvdtllgelnflpgtvfttdlpyvdf
ldrvhkaelklrakgmwevphpwlnlfvpasriadfdrgvfrgvlggrtagaggpvliyp
mnkhkwdprssavtpdeevfylvaflrsalpgapeslealarqnqrildfcagtgigakq
ylpghkarhewaehfgaarwdrfarlkaefdprailaagqgifrp

Sequence, based on observed residues (ATOM records): (download)

>d4oala2 d.58.32.0 (A:247-531) automated matches {Maize (Zea mays) [TaxId: 4577]}
pkrvrwiralysnfseftadqerlislgrrfdyvegfvvaavlyclevtknyddetagsv
dqdvdtllgelnflpgtvfttdlpyvdfldrvhkaelklrakgmwevphpwlnlfvpasr
iadfdrgvfrgvlggpvliypmnkhkwdprssavtpdeevfylvaflrsalpgapeslea
larqnqrildfcagtgigakqylpghkarhewaehfgaarwdrfarlkaefdprailaag
qgifrp

SCOPe Domain Coordinates for d4oala2:

Click to download the PDB-style file with coordinates for d4oala2.
(The format of our PDB-style files is described here.)

Timeline for d4oala2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4oala1