Lineage for d4oala1 (4oal A:40-246)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2987459Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2987460Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 2987703Family d.145.1.0: automated matches [191624] (1 protein)
    not a true family
  6. 2987704Protein automated matches [191143] (13 species)
    not a true protein
  7. 2987714Species Maize (Zea mays) [TaxId:4577] [225479] (20 PDB entries)
  8. 2987729Domain d4oala1: 4oal A:40-246 [270983]
    Other proteins in same PDB: d4oala2, d4oalb2
    automated match to d1w1oa2
    complexed with 245, dms, fad

Details for d4oala1

PDB Entry: 4oal (more details), 1.9 Å

PDB Description: crystal structure of maize cytokinin oxidase/dehydrogenase 4 (zmcko4) in complex with phenylurea inhibitor cppu in alternative spacegroup
PDB Compounds: (A:) Cytokinin dehydrogenase 4

SCOPe Domain Sequences for d4oala1:

Sequence, based on SEQRES records: (download)

>d4oala1 d.145.1.0 (A:40-246) automated matches {Maize (Zea mays) [TaxId: 4577]}
ggrlsvdasdiaeasrdfggvaraepmavfhpraagdvaglvgaafrsargfrvsarghg
hsisgqaqaaggvvvdmsrgrgpgaavaralpvhsaalgghyvdvwggelwvdvlnwtls
hgglaprswtdylylsvggtlsnagisgqafhhgpqisnvyeldvvtgkgevvtcseten
pdlffgvlgglgqfgiitrarialera

Sequence, based on observed residues (ATOM records): (download)

>d4oala1 d.145.1.0 (A:40-246) automated matches {Maize (Zea mays) [TaxId: 4577]}
ggrlsvdasdiaeasrdfggvaraepmavfhpraagdvaglvgaafrsargfrvsarghg
hsisgqaqaaggvvvdmsaralpvhsaalgghyvdvwggelwvdvlnwtlshgglaprsw
tdylylsvggtlsnagisgqafhhgpqisnvyeldvvtgkgevvtcsetenpdlffgvlg
glgqfgiitrarialera

SCOPe Domain Coordinates for d4oala1:

Click to download the PDB-style file with coordinates for d4oala1.
(The format of our PDB-style files is described here.)

Timeline for d4oala1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4oala2