Lineage for d2myya_ (2myy A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1920315Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies)
    beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha
  4. 1920379Superfamily d.100.2: MbtH-like [160582] (2 families) (S)
    the first helix is replaced with an extended loop; contains extra C-terminal helix of variable position
  5. 1920387Family d.100.2.0: automated matches [254253] (1 protein)
    not a true family
  6. 1920388Protein automated matches [254578] (3 species)
    not a true protein
  7. 1920391Species Mycobacterium marinum [TaxId:216594] [270976] (1 PDB entry)
  8. 1920392Domain d2myya_: 2myy A: [270977]
    automated match to d2khra_

Details for d2myya_

PDB Entry: 2myy (more details)

PDB Description: solution structure of an mbth-like protein from mycobacterium marinum, seattle structural genomics center for infectious disease target mymaa.01649.c
PDB Compounds: (A:) Conserved hypothetical MbtH-like protein

SCOPe Domain Sequences for d2myya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2myya_ d.100.2.0 (A:) automated matches {Mycobacterium marinum [TaxId: 216594]}
gpgsmkimsdnpfddedgmffvlindeeqhslwptfadvpagwrvvfgeasrascveyvd
qhwtdirpkslreklasgqg

SCOPe Domain Coordinates for d2myya_:

Click to download the PDB-style file with coordinates for d2myya_.
(The format of our PDB-style files is described here.)

Timeline for d2myya_: