![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies) beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.100.2: MbtH-like [160582] (2 families) ![]() the first helix is replaced with an extended loop; contains extra C-terminal helix of variable position |
![]() | Family d.100.2.0: automated matches [254253] (1 protein) not a true family |
![]() | Protein automated matches [254578] (3 species) not a true protein |
![]() | Species Mycobacterium marinum [TaxId:216594] [270976] (1 PDB entry) |
![]() | Domain d2myya_: 2myy A: [270977] automated match to d2khra_ |
PDB Entry: 2myy (more details)
SCOPe Domain Sequences for d2myya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2myya_ d.100.2.0 (A:) automated matches {Mycobacterium marinum [TaxId: 216594]} gpgsmkimsdnpfddedgmffvlindeeqhslwptfadvpagwrvvfgeasrascveyvd qhwtdirpkslreklasgqg
Timeline for d2myya_: