SCOPe 2.08: Domain d2myya1: 2myy A:5-80

Lineage for d2myya1 (2myy A:5-80)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies)
   beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha

4. Superfamily d.100.2: MbtH-like [160582] (2 families)
   the first helix is replaced with an extended loop; contains extra C-terminal helix of variable position

5. Family d.100.2.0: automated matches [254253] (1 protein)
   not a true family

6. Protein automated matches [254578] (8 species)
   not a true protein

7. Species Mycobacterium marinum [TaxId:216594] [270976] (1 PDB entry)

8. Domain d2myya1: 2myy A:5-80 [270977]
   Other proteins in same PDB: d2myya2
   automated match to d2khra_

Details for d2myya1

PDB Entry: 2myy

PDB Description: solution structure of an mbth-like protein from mycobacterium marinum, seattle structural genomics center for infectious disease target mymaa.01649.c

PDB Compounds: (A:) Conserved hypothetical MbtH-like protein

SCOPe Domain Sequences for d2myya1:

Sequence; same for both SEQRES and ATOM records:

>d2myya1 d.100.2.0 (A:5-80) automated matches {Mycobacterium marinum [TaxId: 216594]}
mkimsdnpfddedgmffvlindeeqhslwptfadvpagwrvvfgeasrascveyvdqhwt
dirpkslreklasgqg

Timeline for d2myya1:

• d2myya1 first appeared in SCOPe 2.05, called d2myya_
  
• d2myya1 appears in SCOPe 2.07