![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
![]() | Protein automated matches [226835] (41 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [270953] (4 PDB entries) |
![]() | Domain d4lpca3: 4lpc A:623-728 [270974] Other proteins in same PDB: d4lpca1, d4lpca2, d4lpcb1, d4lpcb2, d4lpcc1, d4lpcc2, d4lpcd1, d4lpcd2 automated match to d1m7xa2 complexed with bgc, gol |
PDB Entry: 4lpc (more details), 2.39 Å
SCOPe Domain Sequences for d4lpca3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lpca3 b.71.1.0 (A:623-728) automated matches {Escherichia coli [TaxId: 562]} pygfewlvvddkersvlifvrrdkegneiivasnftpvprhdyrfginqpgkwreilntd smhyhgsnagnggtvhsdeiashgrqhslsltlpplatiwlvreae
Timeline for d4lpca3: