Lineage for d4lq1b3 (4lq1 B:623-728)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2419799Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2419800Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2420422Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 2420423Protein automated matches [226835] (41 species)
    not a true protein
  7. 2420499Species Escherichia coli [TaxId:562] [270953] (4 PDB entries)
  8. 2420513Domain d4lq1b3: 4lq1 B:623-728 [270972]
    Other proteins in same PDB: d4lq1a1, d4lq1a2, d4lq1b1, d4lq1b2, d4lq1c1, d4lq1c2, d4lq1d1, d4lq1d2
    automated match to d1m7xa2
    complexed with bgc, glc, gol

Details for d4lq1b3

PDB Entry: 4lq1 (more details), 2.55 Å

PDB Description: crystal structure of e.coli branching enzyme in complex with maltohexaose
PDB Compounds: (B:) 1,4-alpha-glucan branching enzyme GlgB

SCOPe Domain Sequences for d4lq1b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lq1b3 b.71.1.0 (B:623-728) automated matches {Escherichia coli [TaxId: 562]}
pygfewlvvddkersvlifvrrdkegneiivasnftpvprhdyrfginqpgkwreilntd
smhyhgsnagnggtvhsdeiashgrqhslsltlpplatiwlvreae

SCOPe Domain Coordinates for d4lq1b3:

Click to download the PDB-style file with coordinates for d4lq1b3.
(The format of our PDB-style files is described here.)

Timeline for d4lq1b3: