Lineage for d4lpca2 (4lpc A:227-622)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2081497Family c.1.8.1: Amylase, catalytic domain [51446] (26 protein domains)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2081989Protein automated matches [190099] (25 species)
    not a true protein
  7. 2082032Species Escherichia coli [TaxId:562] [270950] (4 PDB entries)
  8. 2082041Domain d4lpca2: 4lpc A:227-622 [270970]
    Other proteins in same PDB: d4lpca1, d4lpca3, d4lpcb1, d4lpcb3, d4lpcc1, d4lpcc3, d4lpcd1, d4lpcd3
    automated match to d1m7xa3
    complexed with bgc, gol

Details for d4lpca2

PDB Entry: 4lpc (more details), 2.39 Å

PDB Description: crystal structure of e.coli branching enzyme in complex with maltoheptaose
PDB Compounds: (A:) 1,4-alpha-glucan branching enzyme GlgB

SCOPe Domain Sequences for d4lpca2:

Sequence, based on SEQRES records: (download)

>d4lpca2 c.1.8.1 (A:227-622) automated matches {Escherichia coli [TaxId: 562]}
vvqteerkkanqfdapisiyevhlgswrrhtdnnfwlsyreladqlvpyakwmgfthlel
lpinehpfdgswgyqptglyaptrrfgtrddfryfidaahaaglnvildwvpghfptddf
alaefdgtnlyehsdpregyhqdwntliynygrrevsnflvgnalywierfgidalrvda
vasmiyrdysrkegewipnefggrenleaieflrntnrilgeqvsgavtmaeestdfpgv
srpqdmgglgfwykwnlgwmhdtldymkldpvyrqyhhdkltfgilynytenfvlplshd
evvhgkksildrmpgdawqkfanlrayygwmwafpgkkllfmgnefaqgrewnhdasldw
hlleggdnwhhgvqrlvrdlnltyrhhkamheldfd

Sequence, based on observed residues (ATOM records): (download)

>d4lpca2 c.1.8.1 (A:227-622) automated matches {Escherichia coli [TaxId: 562]}
vvqteerkkanqfdapisiyevhlgswrrhtdnnfwlsyreladqlvpyakwmgfthlel
lpinehpfdgswgyqptglyaptrrfgtrddfryfidaahaaglnvildwvpghfptddf
alaefdgtnlyehstliynygrrevsnflvgnalywierfgidalrvdavasmiyrggre
nleaieflrntnrilgeqvsgavtmaeestdfpgvsrpqdmgglgfwykwnlgwmhdtld
ymkldpvyrqyhhdkltfgilynytenfvlplshdevvhgkksildrmpgdawqkfanlr
ayygwmwafpgkkllfmgnefaqgrewnhdasldwhlleggdnwhhgvqrlvrdlnltyr
hhkamheldfd

SCOPe Domain Coordinates for d4lpca2:

Click to download the PDB-style file with coordinates for d4lpca2.
(The format of our PDB-style files is described here.)

Timeline for d4lpca2: