Lineage for d4lpca1 (4lpc A:117-226)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766271Species Escherichia coli [TaxId:562] [270946] (4 PDB entries)
  8. 2766280Domain d4lpca1: 4lpc A:117-226 [270966]
    Other proteins in same PDB: d4lpca2, d4lpca3, d4lpcb2, d4lpcb3, d4lpcc2, d4lpcc3, d4lpcd2, d4lpcd3
    automated match to d1m7xa1
    complexed with bgc, gol

Details for d4lpca1

PDB Entry: 4lpc (more details), 2.39 Å

PDB Description: crystal structure of e.coli branching enzyme in complex with maltoheptaose
PDB Compounds: (A:) 1,4-alpha-glucan branching enzyme GlgB

SCOPe Domain Sequences for d4lpca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lpca1 b.1.18.0 (A:117-226) automated matches {Escherichia coli [TaxId: 562]}
thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe
lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpek

SCOPe Domain Coordinates for d4lpca1:

Click to download the PDB-style file with coordinates for d4lpca1.
(The format of our PDB-style files is described here.)

Timeline for d4lpca1: