Lineage for d4lq1b1 (4lq1 B:117-226)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1770169Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1771068Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 1771069Protein automated matches [190226] (43 species)
    not a true protein
  7. 1771159Species Escherichia coli [TaxId:562] [270946] (2 PDB entries)
  8. 1771165Domain d4lq1b1: 4lq1 B:117-226 [270963]
    Other proteins in same PDB: d4lq1a2, d4lq1a3, d4lq1b2, d4lq1b3, d4lq1c2, d4lq1c3, d4lq1d2, d4lq1d3
    automated match to d1m7xa1
    complexed with bgc, gol

Details for d4lq1b1

PDB Entry: 4lq1 (more details), 2.55 Å

PDB Description: crystal structure of e.coli branching enzyme in complex with maltohexaose
PDB Compounds: (B:) 1,4-alpha-glucan branching enzyme GlgB

SCOPe Domain Sequences for d4lq1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lq1b1 b.1.18.0 (B:117-226) automated matches {Escherichia coli [TaxId: 562]}
thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe
lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpek

SCOPe Domain Coordinates for d4lq1b1:

Click to download the PDB-style file with coordinates for d4lq1b1.
(The format of our PDB-style files is described here.)

Timeline for d4lq1b1: