Lineage for d4lpcb3 (4lpc B:623-728)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1804045Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 1804046Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 1804620Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 1804621Protein automated matches [226835] (30 species)
    not a true protein
  7. 1804649Species Escherichia coli [TaxId:562] [270953] (2 PDB entries)
  8. 1804651Domain d4lpcb3: 4lpc B:623-728 [270956]
    Other proteins in same PDB: d4lpca1, d4lpca2, d4lpcb1, d4lpcb2, d4lpcc1, d4lpcc2, d4lpcd1, d4lpcd2
    automated match to d1m7xa2
    complexed with bgc, gol

Details for d4lpcb3

PDB Entry: 4lpc (more details), 2.39 Å

PDB Description: crystal structure of e.coli branching enzyme in complex with maltoheptaose
PDB Compounds: (B:) 1,4-alpha-glucan branching enzyme GlgB

SCOPe Domain Sequences for d4lpcb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lpcb3 b.71.1.0 (B:623-728) automated matches {Escherichia coli [TaxId: 562]}
pygfewlvvddkersvlifvrrdkegneiivasnftpvprhdyrfginqpgkwreilntd
smhyhgsnagnggtvhsdeiashgrqhslsltlpplatiwlvreae

SCOPe Domain Coordinates for d4lpcb3:

Click to download the PDB-style file with coordinates for d4lpcb3.
(The format of our PDB-style files is described here.)

Timeline for d4lpcb3: