Lineage for d1pbob_ (1pbo B:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.60: Lipocalins [50813] (1 superfamily) Superfamily b.60.1: Lipocalins [50814] (3 families) 
Family b.60.1.1: Retinol binding protein-like [50815] (12 proteins) 
Protein Odorant-binding protein [50821] (2 species) 
Species Cow (Bos taurus) [TaxId:9913] [50822] (2 PDB entries) 
Domain d1pbob_: 1pbo B: [27095]
Details for d1pbob_
PDB Entry: 1pbo (more details), 2.2 Å
PDB Description: complex of bovine odorant binding protein (obp) with a selenium containing odorant
SCOP Domain Sequences for d1pbob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pbob_ b.60.1.1 (B:) Odorant-binding protein {Cow (Bos taurus)}
nlselsgpwrtvyigstnpekiqengpfrtyfrelvfddekgtvdfyfsvkrdgkwknvh
vkatkqddgtyvadyegqnvfkivslsrthlvahninvdkhgqkteltglfvklnveded
lekfwkltedkgidkknvvnflenedhphpe
SCOP Domain Coordinates for d1pbob_:
Click to download the PDB-style file with coordinates for d1pbob_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pbob_:
- d1pbob_ appears in SCOP 1.57
- d1pbob_ appears in the current release, SCOPe 2.08
View in 3D
