SCOPe 2.05: Domain d5alcl1: 5alc L:3-108

Lineage for d5alcl1 (5alc L:3-108)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [268548] (95 PDB entries)

8. Domain d5alcl1: 5alc L:3-108 [270943]
   Other proteins in same PDB: d5alcl2
   automated match to d2mcg11
   complexed with tiq

Details for d5alcl1

PDB Entry: 5alc, 1.7 Å

PDB Description: ticagrelor antidote candidate fab 72 in complex with ticagrelor

PDB Compounds: (L:) anti-ticagrelor fab 72, light chain

SCOPe Domain Sequences for d5alcl1:

Sequence; same for both SEQRES and ATOM records:

>d5alcl1 b.1.1.0 (L:3-108) automated matches {Homo sapiens [TaxId: 9606]}
vvtqppsvsaapgqkvtiscsgsnsdignnyvswyqqlpgtapklliydnnkrpsgipdr
fsgsksgtsatlaitglqagdeadyycgtwdislsaglfgggtkvtvlg

Timeline for d5alcl1:

• d5alcl1 is new in SCOPe 2.05-stable
  
• d5alcl1 appears in SCOPe 2.06
  
• d5alcl1 appears in the current release, SCOPe 2.08