Lineage for d5alcl1 (5alc L:3-108)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1030 PDB entries)
  8. 2355684Domain d5alcl1: 5alc L:3-108 [270943]
    Other proteins in same PDB: d5alcl2
    automated match to d2mcg11
    complexed with tiq

Details for d5alcl1

PDB Entry: 5alc (more details), 1.7 Å

PDB Description: ticagrelor antidote candidate fab 72 in complex with ticagrelor
PDB Compounds: (L:) anti-ticagrelor fab 72, light chain

SCOPe Domain Sequences for d5alcl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5alcl1 b.1.1.0 (L:3-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vvtqppsvsaapgqkvtiscsgsnsdignnyvswyqqlpgtapklliydnnkrpsgipdr
fsgsksgtsatlaitglqagdeadyycgtwdislsaglfgggtkvtvlg

SCOPe Domain Coordinates for d5alcl1:

Click to download the PDB-style file with coordinates for d5alcl1.
(The format of our PDB-style files is described here.)

Timeline for d5alcl1: