SCOPe 2.05: Domain d4cvwd_: 4cvw D:

Lineage for d4cvwd_ (4cvw D:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
   4 helices; folded leaf; right-handed superhelix

4. Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families)
   can be classified as disulfide-rich

5. Family a.52.1.0: automated matches [254196] (1 protein)
   not a true family

6. Protein automated matches [254428] (3 species)
   not a true protein

7. Species Hordeum vulgare [TaxId:4513] [270939] (1 PDB entry)

8. Domain d4cvwd_: 4cvw D: [270941]
   automated match to d1tmqb_
   complexed with ca

Details for d4cvwd_

PDB Entry: 4cvw, 2.67 Å

PDB Description: structure of the barley limit dextrinase-limit dextrinase inhibitor complex

PDB Compounds: (D:) limit dextrinase inhibitor

SCOPe Domain Sequences for d4cvwd_:

Sequence; same for both SEQRES and ATOM records:

>d4cvwd_ a.52.1.0 (D:) automated matches {Hordeum vulgare [TaxId: 4513]}
kdecqpgvdfphnplatchtyvikrvcgrgpsrpmlvkerccrelaavpdhcrcealril
mdgvrtpegrvvegrlgdrrdcpreeqrafaatlvtaaecnl

Timeline for d4cvwd_:

• d4cvwd_ is new in SCOPe 2.05-stable
  
• d4cvwd_ appears in SCOPe 2.06
  
• d4cvwd_ appears in the current release, SCOPe 2.08