Lineage for d4cvwd_ (4cvw D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714860Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
    4 helices; folded leaf; right-handed superhelix
  4. 2714861Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families) (S)
    can be classified as disulfide-rich
  5. 2714949Family a.52.1.0: automated matches [254196] (1 protein)
    not a true family
  6. 2714950Protein automated matches [254428] (8 species)
    not a true protein
  7. 2714959Species Barley (Hordeum vulgare) [TaxId:4513] [270939] (1 PDB entry)
  8. 2714961Domain d4cvwd_: 4cvw D: [270941]
    automated match to d1tmqb_
    complexed with ca

Details for d4cvwd_

PDB Entry: 4cvw (more details), 2.67 Å

PDB Description: structure of the barley limit dextrinase-limit dextrinase inhibitor complex
PDB Compounds: (D:) limit dextrinase inhibitor

SCOPe Domain Sequences for d4cvwd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cvwd_ a.52.1.0 (D:) automated matches {Barley (Hordeum vulgare) [TaxId: 4513]}
kdecqpgvdfphnplatchtyvikrvcgrgpsrpmlvkerccrelaavpdhcrcealril
mdgvrtpegrvvegrlgdrrdcpreeqrafaatlvtaaecnl

SCOPe Domain Coordinates for d4cvwd_:

Click to download the PDB-style file with coordinates for d4cvwd_.
(The format of our PDB-style files is described here.)

Timeline for d4cvwd_: