![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily) 4 helices; folded leaf; right-handed superhelix |
![]() | Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families) ![]() can be classified as disulfide-rich |
![]() | Family a.52.1.0: automated matches [254196] (1 protein) not a true family |
![]() | Protein automated matches [254428] (8 species) not a true protein |
![]() | Species Barley (Hordeum vulgare) [TaxId:4513] [270939] (1 PDB entry) |
![]() | Domain d4cvwd_: 4cvw D: [270941] automated match to d1tmqb_ complexed with ca |
PDB Entry: 4cvw (more details), 2.67 Å
SCOPe Domain Sequences for d4cvwd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cvwd_ a.52.1.0 (D:) automated matches {Barley (Hordeum vulgare) [TaxId: 4513]} kdecqpgvdfphnplatchtyvikrvcgrgpsrpmlvkerccrelaavpdhcrcealril mdgvrtpegrvvegrlgdrrdcpreeqrafaatlvtaaecnl
Timeline for d4cvwd_: