SCOPe 2.08: Domain d4cvwc_: 4cvw C:

Lineage for d4cvwc_ (4cvw C:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
   4 helices; folded leaf; right-handed superhelix

4. Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families)
   can be classified as disulfide-rich

5. Family a.52.1.0: automated matches [254196] (1 protein)
   not a true family

6. Protein automated matches [254428] (8 species)
   not a true protein

7. Species Barley (Hordeum vulgare) [TaxId:4513] [270939] (1 PDB entry)

8. Domain d4cvwc_: 4cvw C: [270940]
   automated match to d1tmqb_
   complexed with ca

Details for d4cvwc_

PDB Entry: 4cvw, 2.67 Å

PDB Description: structure of the barley limit dextrinase-limit dextrinase inhibitor complex

PDB Compounds: (C:) limit dextrinase inhibitor

SCOPe Domain Sequences for d4cvwc_:

Sequence; same for both SEQRES and ATOM records:

>d4cvwc_ a.52.1.0 (C:) automated matches {Barley (Hordeum vulgare) [TaxId: 4513]}
ecqpgvdfphnplatchtyvikrvcgrgpsrpmlvkerccrelaavpdhcrcealrilmd
gvrtpegrvvegrlgdrrdcpreeqrafaatlvtaaecnls

Timeline for d4cvwc_:

• d4cvwc_ first appeared in SCOPe 2.05
  
• d4cvwc_ appears in SCOPe 2.07