| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) ![]() share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
| Family c.26.2.4: Universal stress protein-like [52436] (8 proteins) Pfam PF00582 |
| Protein automated matches [190391] (3 species) not a true protein |
| Species Mycobacterium smegmatis [TaxId:246196] [270928] (1 PDB entry) |
| Domain d5ahwd_: 5ahw D: [270938] automated match to d1tq8a_ complexed with cl, cmp, pog, so4 |
PDB Entry: 5ahw (more details), 2.15 Å
SCOPe Domain Sequences for d5ahwd_:
Sequence, based on SEQRES records: (download)
>d5ahwd_ c.26.2.4 (D:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
sayqtvvvgtdgsdsslravdragqiaaasnakliiatayfpqsedsraadvlkdegykm
agnapiyailreandrakaagatdieerpvvgapvdalveladevkadllvvgnvglsti
agrllgsvpanvarrsktdvlivhts
>d5ahwd_ c.26.2.4 (D:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
sayqtvvvgtdgsdsslravdragqiaaasnakliiatayfpqapiyailreandrakaa
gatdieerpvvgapvdalveladevkadllvvgnvglstiagrllgsvpanvarrsktdv
livhts
Timeline for d5ahwd_: