Lineage for d5aesb_ (5aes B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920270Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2920271Protein automated matches [190447] (55 species)
    not a true protein
  7. 2920557Species Mouse (Mus musculus) [TaxId:10090] [193863] (7 PDB entries)
  8. 2920572Domain d5aesb_: 5aes B: [270937]
    Other proteins in same PDB: d5aesa2
    automated match to d4bx2a_
    complexed with 5b0, gol, mg

Details for d5aesb_

PDB Entry: 5aes (more details), 2.75 Å

PDB Description: crystal structure of murine chronophin (pyridoxal phosphate phosphatase) in complex with a pnp-derived inhibitor
PDB Compounds: (B:) pyridoxal phosphate phosphatase

SCOPe Domain Sequences for d5aesb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5aesb_ c.108.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
marcerlrgaalrdvlgqaqgvlfdcdgvlwngerivpgapellqrlaragkntlfvsnn
srrarpelalrfarlgfaglraeqlfssalcaarllrqrlpgppdasgavfvlggeglra
elraaglrlagdpgedprvravlvgydeqfsfsrlteacahlrdpdcllvatdrdpwhpl
sdgsrtpgtgslaaavetasgrqalvvgkpspymfqcitedfsvdpartlmvgdrletdi
lfghrcgmttvltltgvssleeaqayltagqrdlvphyyvesiadlmegle

SCOPe Domain Coordinates for d5aesb_:

Click to download the PDB-style file with coordinates for d5aesb_.
(The format of our PDB-style files is described here.)

Timeline for d5aesb_: