![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.108.1: HAD-like [56784] (26 families) ![]() usually contains an insertion (sub)domain after strand 1 |
![]() | Family c.108.1.0: automated matches [191369] (1 protein) not a true family |
![]() | Protein automated matches [190447] (55 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [193863] (7 PDB entries) |
![]() | Domain d5aesb_: 5aes B: [270937] Other proteins in same PDB: d5aesa2 automated match to d4bx2a_ complexed with 5b0, gol, mg |
PDB Entry: 5aes (more details), 2.75 Å
SCOPe Domain Sequences for d5aesb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5aesb_ c.108.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} marcerlrgaalrdvlgqaqgvlfdcdgvlwngerivpgapellqrlaragkntlfvsnn srrarpelalrfarlgfaglraeqlfssalcaarllrqrlpgppdasgavfvlggeglra elraaglrlagdpgedprvravlvgydeqfsfsrlteacahlrdpdcllvatdrdpwhpl sdgsrtpgtgslaaavetasgrqalvvgkpspymfqcitedfsvdpartlmvgdrletdi lfghrcgmttvltltgvssleeaqayltagqrdlvphyyvesiadlmegle
Timeline for d5aesb_: