Lineage for d5aesa_ (5aes A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1883149Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1883150Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1883848Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 1883849Protein automated matches [190447] (49 species)
    not a true protein
  7. 1884121Species Mouse (Mus musculus) [TaxId:10090] [193863] (7 PDB entries)
  8. 1884135Domain d5aesa_: 5aes A: [270936]
    automated match to d4bx2a_
    complexed with 5b0, gol, mg

Details for d5aesa_

PDB Entry: 5aes (more details), 2.75 Å

PDB Description: crystal structure of murine chronophin (pyridoxal phosphate phosphatase) in complex with a pnp-derived inhibitor
PDB Compounds: (A:) pyridoxal phosphate phosphatase

SCOPe Domain Sequences for d5aesa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5aesa_ c.108.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gmarcerlrgaalrdvlgqaqgvlfdcdgvlwngerivpgapellqrlaragkntlfvsn
nsrrarpelalrfarlgfaglraeqlfssalcaarllrqrlpgppdasgavfvlggeglr
aelraaglrlagdpgedprvravlvgydeqfsfsrlteacahlrdpdcllvatdrdpwhp
lsdgsrtpgtgslaaavetasgrqalvvgkpspymfqcitedfsvdpartlmvgdrletd
ilfghrcgmttvltltgvssleeaqayltagqrdlvphyyvesiadlmegl

SCOPe Domain Coordinates for d5aesa_:

Click to download the PDB-style file with coordinates for d5aesa_.
(The format of our PDB-style files is described here.)

Timeline for d5aesa_:

  • d5aesa_ appears in periodic updates to SCOPe 2.05 starting on 2015-04-02
  • d5aesa_ is called d5aesa1 in SCOPe 2.06
  • d5aesa_ appears in the current release, SCOPe 2.07, called d5aesa1