Lineage for d5ahwe_ (5ahw E:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1841351Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1842253Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 1842444Family c.26.2.4: Universal stress protein-like [52436] (8 proteins)
    Pfam PF00582
  6. 1842482Protein automated matches [190391] (3 species)
    not a true protein
  7. 1842483Species Mycobacterium smegmatis [TaxId:246196] [270928] (1 PDB entry)
  8. 1842488Domain d5ahwe_: 5ahw E: [270935]
    automated match to d1tq8a_
    complexed with cl, cmp, pog, so4

Details for d5ahwe_

PDB Entry: 5ahw (more details), 2.15 Å

PDB Description: crystal structure of universal stress protein msmeg_3811 in complex with camp
PDB Compounds: (E:) Universal stress protein

SCOPe Domain Sequences for d5ahwe_:

Sequence, based on SEQRES records: (download)

>d5ahwe_ c.26.2.4 (E:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
sayqtvvvgtdgsdsslravdragqiaaasnakliiatayfpqsedsraadvlkdegykm
agnapiyailreandrakaagatdieerpvvgapvdalveladevkadllvvgnvglsti
agrllgsvpanvarrsktdvlivhts

Sequence, based on observed residues (ATOM records): (download)

>d5ahwe_ c.26.2.4 (E:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
sayqtvvvgtdgsdsslravdragqiaaasnakliiatayfpapiyailreandrakaag
atdieerpvvgapvdalveladevkadllvvgnvglstiagrllgsvpanvarrsktdvl
ivhts

SCOPe Domain Coordinates for d5ahwe_:

Click to download the PDB-style file with coordinates for d5ahwe_.
(The format of our PDB-style files is described here.)

Timeline for d5ahwe_: