Lineage for d5ahwc_ (5ahw C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2861263Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2861467Family c.26.2.4: Universal stress protein-like [52436] (8 proteins)
    Pfam PF00582
  6. 2861505Protein automated matches [190391] (3 species)
    not a true protein
  7. 2861506Species Mycobacterium smegmatis [TaxId:246196] [270928] (1 PDB entry)
  8. 2861509Domain d5ahwc_: 5ahw C: [270933]
    automated match to d1tq8a_
    complexed with cl, cmp, pog, so4

Details for d5ahwc_

PDB Entry: 5ahw (more details), 2.15 Å

PDB Description: crystal structure of universal stress protein msmeg_3811 in complex with camp
PDB Compounds: (C:) Universal stress protein

SCOPe Domain Sequences for d5ahwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ahwc_ c.26.2.4 (C:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
sayqtvvvgtdgsdsslravdragqiaaasnakliiatayfpqsedsraadvlkdegykm
agnapiyailreandrakaagatdieerpvvgapvdalveladevkadllvvgnvglsti
agrllgsvpanvarrsktdvlivhts

SCOPe Domain Coordinates for d5ahwc_:

Click to download the PDB-style file with coordinates for d5ahwc_.
(The format of our PDB-style files is described here.)

Timeline for d5ahwc_: