SCOPe 2.08: Domain d5ahwc_: 5ahw C:

Lineage for d5ahwc_ (5ahw C:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.4: Universal stress protein-like [52436] (8 proteins)
   Pfam PF00582

6. Protein automated matches [190391] (3 species)
   not a true protein

7. Species Mycobacterium smegmatis [TaxId:246196] [270928] (1 PDB entry)

8. Domain d5ahwc_: 5ahw C: [270933]
   automated match to d1tq8a_
   complexed with cl, cmp, pog, so4

Details for d5ahwc_

PDB Entry: 5ahw, 2.15 Å

PDB Description: crystal structure of universal stress protein msmeg_3811 in complex with camp

PDB Compounds: (C:) Universal stress protein

SCOPe Domain Sequences for d5ahwc_:

Sequence; same for both SEQRES and ATOM records:

>d5ahwc_ c.26.2.4 (C:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
sayqtvvvgtdgsdsslravdragqiaaasnakliiatayfpqsedsraadvlkdegykm
agnapiyailreandrakaagatdieerpvvgapvdalveladevkadllvvgnvglsti
agrllgsvpanvarrsktdvlivhts

Timeline for d5ahwc_:

• d5ahwc_ first appeared in SCOPe 2.05
  
• d5ahwc_ appears in SCOPe 2.07