SCOPe 2.06: Domain d1obpb_: 1obp B:

Lineage for d1obpb_ (1obp B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Odorant-binding protein [50821] (2 species)
   C-termini swapping dimer

7. Species Cow (Bos taurus) [TaxId:9913] [50822] (8 PDB entries)

8. Domain d1obpb_: 1obp B: [27093]
   complexed with unx

Details for d1obpb_

PDB Entry: 1obp, 2 Å

PDB Description: odorant-binding protein from bovine nasal mucosa

PDB Compounds: (B:) odorant-binding protein

SCOPe Domain Sequences for d1obpb_:

Sequence; same for both SEQRES and ATOM records:

>d1obpb_ b.60.1.1 (B:) Odorant-binding protein {Cow (Bos taurus) [TaxId: 9913]}
eeeaeqnlselsgpwrtvyigstnpekiqengpfrtyfrelvfddekgtvdfyfsvkrdg
kwknvhvkatkqddgtyvadyegqnvfkivslsrthlvahninvdkhgqtteltglfvkl
nvededlekfwkltedkgidkknvvnflenedhph

Timeline for d1obpb_:

• d1obpb_ first appeared (with stable ids) in SCOP 1.55
  
• d1obpb_ appears in SCOPe 2.05
  
• d1obpb_ appears in SCOPe 2.07
  
• d1obpb_ appears in the current release, SCOPe 2.08