Lineage for d1obpb_ (1obp B:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.60: Lipocalins [50813] (1 superfamily) Superfamily b.60.1: Lipocalins [50814] (3 families) 
Family b.60.1.1: Retinol binding protein-like [50815] (12 proteins) 
Protein Odorant-binding protein [50821] (2 species) 
Species Cow (Bos taurus) [TaxId:9913] [50822] (2 PDB entries) 
Domain d1obpb_: 1obp B: [27093]
Details for d1obpb_
PDB Entry: 1obp (more details), 2 Å
PDB Description: odorant-binding protein from bovine nasal mucosa
SCOP Domain Sequences for d1obpb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1obpb_ b.60.1.1 (B:) Odorant-binding protein {Cow (Bos taurus)}
eeeaeqnlselsgpwrtvyigstnpekiqengpfrtyfrelvfddekgtvdfyfsvkrdg
kwknvhvkatkqddgtyvadyegqnvfkivslsrthlvahninvdkhgqtteltglfvkl
nvededlekfwkltedkgidkknvvnflenedhph
SCOP Domain Coordinates for d1obpb_:
Click to download the PDB-style file with coordinates for d1obpb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1obpb_:
- d1obpb_ appears in SCOP 1.57
- d1obpb_ appears in the current release, SCOPe 2.08
View in 3D
