Lineage for d4yqzb1 (4yqz B:2-234)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2848926Species Thermus thermophilus [TaxId:262724] [270920] (3 PDB entries)
  8. 2848940Domain d4yqzb1: 4yqz B:2-234 [270922]
    Other proteins in same PDB: d4yqza2, d4yqzb2, d4yqzc2, d4yqzd2
    automated match to d4bo8c_
    complexed with cl

Details for d4yqzb1

PDB Entry: 4yqz (more details), 1.81 Å

PDB Description: crystal structure of a putative oxidoreductase from thermus thermophilus hb27 (tt_p0034, target efi-513932) in its apo form
PDB Compounds: (B:) Putative oxidoreductase

SCOPe Domain Sequences for d4yqzb1:

Sequence, based on SEQRES records: (download)

>d4yqzb1 c.2.1.0 (B:2-234) automated matches {Thermus thermophilus [TaxId: 262724]}
klkgkkalviaagqgigraiaeafqregaevlgatlhpeklqgvvpavrldardkeavfr
liqgldrldvlvnaqgvvpvgglleatdqdweeafllnaksvfwamqaalpkmaaqgggs
viniasvaafktvpgrfiysatkaalvamtkaaalefapkgvrvnaicpgtvdtpslrer
aggeeglrafaerqllkrlgrpeeiaalavylasdegafatgsafvvdggmsl

Sequence, based on observed residues (ATOM records): (download)

>d4yqzb1 c.2.1.0 (B:2-234) automated matches {Thermus thermophilus [TaxId: 262724]}
klkgkkalviaagqgigraiaeafqregaevlgatlhpeklqgvvpavrldardkeavfr
liqgldrldvlvnaqgvvpvgglleatdqdweeafllnaksvfwamqaalpkmaaqgggs
viniasvaafktvpgrfiysatkaalvamtkaaalefapkgvrvnaicpgtvdtpslrer
aeglrafaerqllkrlgrpeeiaalavylasdegafatgsafvvdggmsl

SCOPe Domain Coordinates for d4yqzb1:

Click to download the PDB-style file with coordinates for d4yqzb1.
(The format of our PDB-style files is described here.)

Timeline for d4yqzb1: