SCOP 1.57: Domain d1obpa_: 1obp A:

Lineage for d1obpa_ (1obp A:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)

4. Superfamily b.60.1: Lipocalins [50814] (3 families)

5. Family b.60.1.1: Retinol binding protein-like [50815] (14 proteins)

6. Protein Odorant-binding protein [50821] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50822] (2 PDB entries)

8. Domain d1obpa_: 1obp A: [27092]

Details for d1obpa_

PDB Entry: 1obp, 2 Å

PDB Description: odorant-binding protein from bovine nasal mucosa

SCOP Domain Sequences for d1obpa_:

Sequence; same for both SEQRES and ATOM records:

>d1obpa_ b.60.1.1 (A:) Odorant-binding protein {Cow (Bos taurus)}
qeeeaeqnlselsgpwrtvyigstnpekiqengpfrtyfrelvfddekgtvdfyfsvkrd
gkwknvhvkatkqddgtyvadyegqnvfkivslsrthlvahninvdkhgqtteltglfvk
lnvededlekfwkltedkgidkknvvnflenedhphpe

Timeline for d1obpa_:

• d1obpa_ first appeared (with stable ids) in SCOP 1.55
  
• d1obpa_ appears in SCOP 1.59
  
• d1obpa_ appears in the current release, SCOPe 2.08