Lineage for d4y95c1 (4y95 C:395-659)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2983276Protein automated matches [190091] (20 species)
    not a true protein
  7. 2983331Species Cow (Bos taurus) [TaxId:9913] [187007] (28 PDB entries)
  8. 2983340Domain d4y95c1: 4y95 C:395-659 [270916]
    Other proteins in same PDB: d4y95a2, d4y95b2, d4y95c2
    automated match to d3pj2a_
    complexed with 746, bme, gol, pe4; mutant

Details for d4y95c1

PDB Entry: 4y95 (more details), 1.6 Å

PDB Description: crystal structure of the kinase domain of bruton's tyrosine kinase with mutations in the activation loop
PDB Compounds: (C:) Non-specific protein-tyrosine kinase

SCOPe Domain Sequences for d4y95c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4y95c1 d.144.1.7 (C:395-659) automated matches {Cow (Bos taurus) [TaxId: 9913]}
weidpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakvmmnlsh
eklvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvceameyles
kqflhrdlaarnclvndqgvvkvsdfgmtrfvlddeytsstgtkfpvkwaspevlmyskf
ssksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlprphlaservyaimyscw
hekaderptfkillsnildvmdees

SCOPe Domain Coordinates for d4y95c1:

Click to download the PDB-style file with coordinates for d4y95c1.
(The format of our PDB-style files is described here.)

Timeline for d4y95c1: