SCOPe 2.05: Domain d4yijb_: 4yij B:

Lineage for d4yijb_ (4yij B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family)

5. Family b.40.1.1: Staphylococcal nuclease [50200] (2 proteins)
   barrel, closed; n=5, S=10

6. Protein Staphylococcal nuclease [50201] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [50202] (227 PDB entries)
   Uniprot P00644 89-223

8. Domain d4yijb_: 4yij B: [270912]
   automated match to d2lkva_
   complexed with ca, thp

Details for d4yijb_

PDB Entry: 4yij, 1.64 Å

PDB Description: crystal structure of staphylcoccal nuclease variant delta+phs a109e at cryogenic temperature

PDB Compounds: (B:) Nuclease A

SCOPe Domain Sequences for d4yijb_:

Sequence; same for both SEQRES and ATOM records:

>d4yijb_ b.40.1.1 (B:) Staphylococcal nuclease {Staphylococcus aureus [TaxId: 1280]}
atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkmv
enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglekvayvykgnntheqllr
kaeaqakkeklniwse

Timeline for d4yijb_:

• d4yijb_ is new in SCOPe 2.05-stable
  
• d4yijb_ appears in SCOPe 2.06
  
• d4yijb_ appears in the current release, SCOPe 2.08