SCOP 1.75: Domain d1rlbf_: 1rlb F:

Lineage for d1rlbf_ (1rlb F:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (9 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (21 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Retinol binding protein [50816] (5 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [50820] (1 PDB entry)

8. Domain d1rlbf_: 1rlb F: [27091]
   Other proteins in same PDB: d1rlba_, d1rlbb_, d1rlbc_, d1rlbd_
   complexed with rea

Details for d1rlbf_

PDB Entry: 1rlb, 3.1 Å

PDB Description: retinol binding protein complexed with transthyretin

PDB Compounds: (F:) retinol binding protein

SCOP Domain Sequences for d1rlbf_:

Sequence; same for both SEQRES and ATOM records:

>d1rlbf_ b.60.1.1 (F:) Retinol binding protein {Chicken (Gallus gallus) [TaxId: 9031]}
erdcrvssfrvkenfdkarfagtwyamakkdpeglflqdnivaefsvdenghmsatakgr
vrllnnwdvcadmvgtftdtedpakfkmkywgvasflqkgnddhwiidtdyetfavqysc
rllnldgtcadsysfvfardpsgfspqvqkivrqrqeelclarqyrliphngyc

Timeline for d1rlbf_:

• d1rlbf_ first appeared (with stable ids) in SCOP 1.55
  
• d1rlbf_ appears in SCOP 1.73
  
• d1rlbf_ appears in SCOPe 2.01
  
• d1rlbf_ appears in the current release, SCOPe 2.08