Lineage for d1rlbf_ (1rlb F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2804248Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2804714Protein Retinol binding protein [50816] (5 species)
  7. 2804715Species Chicken (Gallus gallus) [TaxId:9031] [50820] (1 PDB entry)
  8. 2804717Domain d1rlbf_: 1rlb F: [27091]
    Other proteins in same PDB: d1rlba_, d1rlbb_, d1rlbc_, d1rlbd_
    complexed with rea

Details for d1rlbf_

PDB Entry: 1rlb (more details), 3.1 Å

PDB Description: retinol binding protein complexed with transthyretin
PDB Compounds: (F:) retinol binding protein

SCOPe Domain Sequences for d1rlbf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rlbf_ b.60.1.1 (F:) Retinol binding protein {Chicken (Gallus gallus) [TaxId: 9031]}
erdcrvssfrvkenfdkarfagtwyamakkdpeglflqdnivaefsvdenghmsatakgr
vrllnnwdvcadmvgtftdtedpakfkmkywgvasflqkgnddhwiidtdyetfavqysc
rllnldgtcadsysfvfardpsgfspqvqkivrqrqeelclarqyrliphngyc

SCOPe Domain Coordinates for d1rlbf_:

Click to download the PDB-style file with coordinates for d1rlbf_.
(The format of our PDB-style files is described here.)

Timeline for d1rlbf_: