Lineage for d1rlbe_ (1rlb E:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 957981Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 957982Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 957983Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 958269Protein Retinol binding protein [50816] (5 species)
  7. 958270Species Chicken (Gallus gallus) [TaxId:9031] [50820] (1 PDB entry)
  8. 958271Domain d1rlbe_: 1rlb E: [27090]
    Other proteins in same PDB: d1rlba_, d1rlbb_, d1rlbc_, d1rlbd_
    complexed with rea

Details for d1rlbe_

PDB Entry: 1rlb (more details), 3.1 Å

PDB Description: retinol binding protein complexed with transthyretin
PDB Compounds: (E:) retinol binding protein

SCOPe Domain Sequences for d1rlbe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rlbe_ b.60.1.1 (E:) Retinol binding protein {Chicken (Gallus gallus) [TaxId: 9031]}
erdcrvssfrvkenfdkarfagtwyamakkdpeglflqdnivaefsvdenghmsatakgr
vrllnnwdvcadmvgtftdtedpakfkmkywgvasflqkgnddhwiidtdyetfavqysc
rllnldgtcadsysfvfardpsgfspqvqkivrqrqeelclarqyrliphngyc

SCOPe Domain Coordinates for d1rlbe_:

Click to download the PDB-style file with coordinates for d1rlbe_.
(The format of our PDB-style files is described here.)

Timeline for d1rlbe_: