SCOPe 2.06: Domain d4y5xb1: 4y5x B:1-97

Lineage for d4y5xb1 (4y5x B:1-97)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d4y5xb1: 4y5x B:1-97 [270899]
   Other proteins in same PDB: d4y5xa_, d4y5xb2, d4y5xc1, d4y5xc2, d4y5xd_, d4y5xe2, d4y5xf1, d4y5xf2, d4y5xg_, d4y5xh2, d4y5xi1, d4y5xi2, d4y5xj_, d4y5xk2, d4y5xl1, d4y5xl2
   automated match to d3t0va_
   complexed with flc, peg

Details for d4y5xb1

PDB Entry: 4y5x, 3.15 Å

PDB Description: diabody 305 complex with epor

PDB Compounds: (B:) diabody 310 VH domain

SCOPe Domain Sequences for d4y5xb1:

Sequence; same for both SEQRES and ATOM records:

>d4y5xb1 b.1.1.0 (B:1-97) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qsvltqppsvseapgqrvtiacsgsssnignnavswyqqlpgkaptlliyydnllpsgvs
drfsgsksgtsaslaisglqsedeadyycaawddsln

Timeline for d4y5xb1:

• d4y5xb1 first appeared in SCOPe 2.05, called d4y5xb_
  
• d4y5xb1 appears in SCOPe 2.07
  
• d4y5xb1 appears in the current release, SCOPe 2.08