SCOPe 2.06: Domain d4y94a_: 4y94 A:

Lineage for d4y94a_ (4y94 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
   Pfam PF00169

6. Protein automated matches [190063] (3 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [270894] (1 PDB entry)

8. Domain d4y94a_: 4y94 A: [270896]
   Other proteins in same PDB: d4y94b2, d4y94d2
   automated match to d1b55a_
   complexed with ihp, zn

Details for d4y94a_

PDB Entry: 4y94, 2.4 Å

PDB Description: crystal structure of the ph-th module of bruton's tyrosine kinase bound to inositol hexakisphosphate

PDB Compounds: (A:) Non-specific protein-tyrosine kinase

SCOPe Domain Sequences for d4y94a_:

Sequence, based on SEQRES records:

>d4y94a_ b.55.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
atvilesiflkrsqqkkktsplnfkkrlflltvqklsyyeydfergrrgskkgsidveki
tcvetvvpeknppperqiprrgeesseteqisiierfpypfqvvydegplyvfspteelr
krwihqlknvirynsdlvqkyhpcfwidgqylccsqtaknamgcqil

Sequence, based on observed residues (ATOM records):

>d4y94a_ b.55.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
atvilesiflkrssplnfkkrlflltvqklsyyeydfergrrgskkgsidvekitcvetv
vpeknppperqipeesseteqisiierfpypfqvvydegplyvfspteelrkrwihqlkn
virynsdlvqkyhpcfwidgqylccsqtaknamgcqil

Timeline for d4y94a_:

• d4y94a_ first appeared in SCOPe 2.05
  
• d4y94a_ appears in SCOPe 2.07
  
• d4y94a_ appears in the current release, SCOPe 2.08