![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (24 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries) |
![]() | Domain d4y5xj_: 4y5x J: [270892] Other proteins in same PDB: d4y5xb1, d4y5xb2, d4y5xc1, d4y5xc2, d4y5xe1, d4y5xe2, d4y5xf1, d4y5xf2, d4y5xh1, d4y5xh2, d4y5xi1, d4y5xi2, d4y5xk1, d4y5xk2, d4y5xl1, d4y5xl2 automated match to d4kfzc_ complexed with flc, peg |
PDB Entry: 4y5x (more details), 3.15 Å
SCOPe Domain Sequences for d4y5xj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4y5xj_ b.1.1.1 (J:) automated matches {Human (Homo sapiens) [TaxId: 9606]} evqllesggglvqpggslrlscaasgftfssyamswvrqapgkglewvsaisgsggstyy adsvkgrftisrdnskntlylqmnslraedtavyycvkdrvavagkgsyyfdswgrgttv tvss
Timeline for d4y5xj_: