SCOP 1.75: Domain d1qabf_: 1qab F:

Lineage for d1qabf_ (1qab F:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (9 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (21 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Retinol binding protein [50816] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50819] (4 PDB entries)

8. Domain d1qabf_: 1qab F: [27089]
   Other proteins in same PDB: d1qaba_, d1qabb_, d1qabc_, d1qabd_
   complexed with rtl

Details for d1qabf_

PDB Entry: 1qab, 3.2 Å

PDB Description: The structure of human retinol binding protein with its carrier protein transthyretin reveals interaction with the carboxy terminus of RBP

PDB Compounds: (F:) PROTEIN (retinol binding protein)

SCOP Domain Sequences for d1qabf_:

Sequence; same for both SEQRES and ATOM records:

>d1qabf_ b.60.1.1 (F:) Retinol binding protein {Human (Homo sapiens) [TaxId: 9606]}
cavssfrvkenfdkarfsgtwyamakkdpeglflqdnivaefsvdetgqmsatakgrvrl
lnnwdvcadmvgtftdtedpakfkmkywgvasflqkgnddhwivdtdydtyavqyscrll
nldgtcadsysfvfsrdpnglppeaqkivaqrqeelclaaqyrlivhngyc

Timeline for d1qabf_:

• d1qabf_ first appeared (with stable ids) in SCOP 1.55
  
• d1qabf_ appears in SCOP 1.73
  
• d1qabf_ appears in SCOPe 2.01
  
• d1qabf_ appears in the current release, SCOPe 2.08