Lineage for d1qabf_ (1qab F:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 16455Fold b.60: Lipocalins [50813] (1 superfamily)
  4. 16456Superfamily b.60.1: Lipocalins [50814] (3 families) (S)
  5. 16457Family b.60.1.1: Retinol binding protein-like [50815] (12 proteins)
  6. 16560Protein Retinol binding protein [50816] (4 species)
  7. 16571Species Human (Homo sapiens) [TaxId:9606] [50819] (4 PDB entries)
  8. 16576Domain d1qabf_: 1qab F: [27089]
    Other proteins in same PDB: d1qaba_, d1qabb_, d1qabc_, d1qabd_

Details for d1qabf_

PDB Entry: 1qab (more details), 3.2 Å

PDB Description: The structure of human retinol binding protein with its carrier protein transthyretin reveals interaction with the carboxy terminus of RBP
PDB Compounds: (F:)

SCOP Domain Sequences for d1qabf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qabf_ b.60.1.1 (F:) Retinol binding protein {Human (Homo sapiens)}
cavssfrvkenfdkarfsgtwyamakkdpeglflqdnivaefsvdetgqmsatakgrvrl
lnnwdvcadmvgtftdtedpakfkmkywgvasflqkgnddhwivdtdydtyavqyscrll
nldgtcadsysfvfsrdpnglppeaqkivaqrqeelclaaqyrlivhngyc

SCOP Domain Coordinates for d1qabf_:

Click to download the PDB-style file with coordinates for d1qabf_.
(The format of our PDB-style files is described here.)

Timeline for d1qabf_: