SCOPe 2.08: Domain d4y5xl1: 4y5x L:11-116

Lineage for d4y5xl1 (4y5x L:11-116)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein automated matches [190888] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188282] (33 PDB entries)

8. Domain d4y5xl1: 4y5x L:11-116 [270886]
   Other proteins in same PDB: d4y5xa_, d4y5xb1, d4y5xb2, d4y5xd_, d4y5xe1, d4y5xe2, d4y5xg_, d4y5xh1, d4y5xh2, d4y5xj_, d4y5xk1, d4y5xk2
   automated match to d1eerb1
   complexed with flc, peg

Details for d4y5xl1

PDB Entry: 4y5x, 3.15 Å

PDB Description: diabody 305 complex with epor

PDB Compounds: (L:) erythropoietin receptor

SCOPe Domain Sequences for d4y5xl1:

Sequence, based on SEQRES records:

>d4y5xl1 b.1.2.1 (L:11-116) automated matches {Human (Homo sapiens) [TaxId: 9606]}
feskaallaargpeellcfterledlvcfweeaasagvgpgqysfsyqledepwklcrlh
qaptargavrfwcslptadtssfvplelrvtaasgapryhrvihin

Sequence, based on observed residues (ATOM records):

>d4y5xl1 b.1.2.1 (L:11-116) automated matches {Human (Homo sapiens) [TaxId: 9606]}
feskaallaargpeellcfterledlvcfweeapgqysfsyqledepwklcrlhqaptaa
vrfwcslptadtssfvplelrvtaasgapryhrvihin

Timeline for d4y5xl1:

• d4y5xl1 first appeared in SCOPe 2.05
  
• d4y5xl1 appears in SCOPe 2.07