Lineage for d1qabe_ (1qab E:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2071989Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2071990Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2071991Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2072408Protein Retinol binding protein [50816] (5 species)
  7. 2072426Species Human (Homo sapiens) [TaxId:9606] [50819] (9 PDB entries)
  8. 2072436Domain d1qabe_: 1qab E: [27088]
    Other proteins in same PDB: d1qaba_, d1qabb_, d1qabc_, d1qabd_
    complexed with rtl

Details for d1qabe_

PDB Entry: 1qab (more details), 3.2 Å

PDB Description: The structure of human retinol binding protein with its carrier protein transthyretin reveals interaction with the carboxy terminus of RBP
PDB Compounds: (E:) PROTEIN (retinol binding protein)

SCOPe Domain Sequences for d1qabe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qabe_ b.60.1.1 (E:) Retinol binding protein {Human (Homo sapiens) [TaxId: 9606]}
cavssfrvkenfdkarfsgtwyamakkdpeglflqdnivaefsvdetgqmsatakgrvrl
lnnwdvcadmvgtftdtedpakfkmkywgvasflqkgnddhwivdtdydtyavqyscrll
nldgtcadsysfvfsrdpnglppeaqkivaqrqeelclaaqyrlivhngycdgrsernll

SCOPe Domain Coordinates for d1qabe_:

Click to download the PDB-style file with coordinates for d1qabe_.
(The format of our PDB-style files is described here.)

Timeline for d1qabe_: