Class b: All beta proteins [48724] (177 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins) barrel, closed; n=8, S=12, meander |
Protein Retinol binding protein [50816] (5 species) |
Species Human (Homo sapiens) [TaxId:9606] [50819] (9 PDB entries) |
Domain d1qabe_: 1qab E: [27088] Other proteins in same PDB: d1qaba_, d1qabb_, d1qabc_, d1qabd_ complexed with rtl |
PDB Entry: 1qab (more details), 3.2 Å
SCOPe Domain Sequences for d1qabe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qabe_ b.60.1.1 (E:) Retinol binding protein {Human (Homo sapiens) [TaxId: 9606]} cavssfrvkenfdkarfsgtwyamakkdpeglflqdnivaefsvdetgqmsatakgrvrl lnnwdvcadmvgtftdtedpakfkmkywgvasflqkgnddhwivdtdydtyavqyscrll nldgtcadsysfvfsrdpnglppeaqkivaqrqeelclaaqyrlivhngycdgrsernll
Timeline for d1qabe_: