Lineage for d1qabe_ (1qab E:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 62088Fold b.60: Lipocalins [50813] (1 superfamily)
  4. 62089Superfamily b.60.1: Lipocalins [50814] (3 families) (S)
  5. 62090Family b.60.1.1: Retinol binding protein-like [50815] (14 proteins)
  6. 62207Protein Retinol binding protein [50816] (4 species)
  7. 62218Species Human (Homo sapiens) [TaxId:9606] [50819] (4 PDB entries)
  8. 62222Domain d1qabe_: 1qab E: [27088]
    Other proteins in same PDB: d1qaba_, d1qabb_, d1qabc_, d1qabd_

Details for d1qabe_

PDB Entry: 1qab (more details), 3.2 Å

PDB Description: The structure of human retinol binding protein with its carrier protein transthyretin reveals interaction with the carboxy terminus of RBP

SCOP Domain Sequences for d1qabe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qabe_ b.60.1.1 (E:) Retinol binding protein {Human (Homo sapiens)}
cavssfrvkenfdkarfsgtwyamakkdpeglflqdnivaefsvdetgqmsatakgrvrl
lnnwdvcadmvgtftdtedpakfkmkywgvasflqkgnddhwivdtdydtyavqyscrll
nldgtcadsysfvfsrdpnglppeaqkivaqrqeelclaaqyrlivhngycdgrsernll

SCOP Domain Coordinates for d1qabe_:

Click to download the PDB-style file with coordinates for d1qabe_.
(The format of our PDB-style files is described here.)

Timeline for d1qabe_: