![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
![]() | Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
![]() | Protein automated matches [190888] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188282] (33 PDB entries) |
![]() | Domain d4y5xc1: 4y5x C:11-116 [270878] Other proteins in same PDB: d4y5xa_, d4y5xb1, d4y5xb2, d4y5xd_, d4y5xe1, d4y5xe2, d4y5xg_, d4y5xh1, d4y5xh2, d4y5xj_, d4y5xk1, d4y5xk2 automated match to d1eerb1 complexed with flc, peg |
PDB Entry: 4y5x (more details), 3.15 Å
SCOPe Domain Sequences for d4y5xc1:
Sequence, based on SEQRES records: (download)
>d4y5xc1 b.1.2.1 (C:11-116) automated matches {Human (Homo sapiens) [TaxId: 9606]} feskaallaargpeellcfterledlvcfweeaasagvgpgqysfsyqledepwklcrlh qaptargavrfwcslptadtssfvplelrvtaasgapryhrvihin
>d4y5xc1 b.1.2.1 (C:11-116) automated matches {Human (Homo sapiens) [TaxId: 9606]} feskaallaargpeellcfterledlvcfweeapgqysfsyqledepwklcrlhqaptar gavrfwcslptadtssfvplelrvtaasgapryhrvihin
Timeline for d4y5xc1: