Lineage for d4xlva_ (4xlv A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2218179Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2219815Protein Insulin receptor [56162] (1 species)
    PTK group; InsR subfamily; membrane spanning protein tyrosine kinase
  7. 2219816Species Human (Homo sapiens) [TaxId:9606] [56163] (18 PDB entries)
  8. 2219836Domain d4xlva_: 4xlv A: [270870]
    automated match to d1p4ob_
    complexed with acp, mg

Details for d4xlva_

PDB Entry: 4xlv (more details), 2.3 Å

PDB Description: crystal structure of the activated insulin receptor tyrosine kinase dimer
PDB Compounds: (A:) Insulin receptor

SCOPe Domain Sequences for d4xlva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xlva_ d.144.1.7 (A:) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]}
sasdvfpssvyvpdewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvn
esaslrerieflneasvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrp
eaennpgrppptlqemiqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgm
trdiyetdyyrkggkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqgl
sneqvlkfvmdggyldqpdncpervtdlmrmcwqfnpnmrptfleivnllkddlhpsfpe
vsffhseenk

SCOPe Domain Coordinates for d4xlva_:

Click to download the PDB-style file with coordinates for d4xlva_.
(The format of our PDB-style files is described here.)

Timeline for d4xlva_: