Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Insulin receptor [56162] (1 species) PTK group; InsR subfamily; membrane spanning protein tyrosine kinase |
Species Human (Homo sapiens) [TaxId:9606] [56163] (18 PDB entries) |
Domain d4xlva_: 4xlv A: [270870] automated match to d1p4ob_ complexed with acp, mg |
PDB Entry: 4xlv (more details), 2.3 Å
SCOPe Domain Sequences for d4xlva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xlva_ d.144.1.7 (A:) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} sasdvfpssvyvpdewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvn esaslrerieflneasvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrp eaennpgrppptlqemiqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgm trdiyetdyyrkggkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqgl sneqvlkfvmdggyldqpdncpervtdlmrmcwqfnpnmrptfleivnllkddlhpsfpe vsffhseenk
Timeline for d4xlva_: