Lineage for d1brq__ (1brq -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 16455Fold b.60: Lipocalins [50813] (1 superfamily)
  4. 16456Superfamily b.60.1: Lipocalins [50814] (3 families) (S)
  5. 16457Family b.60.1.1: Retinol binding protein-like [50815] (12 proteins)
  6. 16560Protein Retinol binding protein [50816] (4 species)
  7. 16571Species Human (Homo sapiens) [TaxId:9606] [50819] (4 PDB entries)
  8. 16574Domain d1brq__: 1brq - [27087]

Details for d1brq__

PDB Entry: 1brq (more details), 2.5 Å

PDB Description: crystal structure of the trigonal form of human plasma retinol-binding protein at 2.5 angstroms resolution

SCOP Domain Sequences for d1brq__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1brq__ b.60.1.1 (-) Retinol binding protein {Human (Homo sapiens)}
erdcrvssfrvkenfdkarfsgtwyamakkdpeglflqdnivaefsvdetgqmsatakgr
vrllnnwdvcadmvgtftdtedpakfkmkywgvasflqkgnddhwivdtdydtyavqysc
rllnldgtcadsysfvfsrdpnglppeaqkivrqrqeelclarqyrlivhngycd

SCOP Domain Coordinates for d1brq__:

Click to download the PDB-style file with coordinates for d1brq__.
(The format of our PDB-style files is described here.)

Timeline for d1brq__: