SCOPe 2.07: Domain d4xxra_: 4xxr A:

Lineage for d4xxra_ (4xxr A:)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein automated matches [190161] (30 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187306] (106 PDB entries)

8. Domain d4xxra_: 4xxr A: [270868]
   automated match to d1ylta_
   complexed with jsc, jsd, jse, k

Details for d4xxra_

PDB Entry: 4xxr, 1.18 Å

PDB Description: atomic resolution x-ray crystal structure of a ruthenocene conjugated beta-lactam antibiotic in complex with ctx-m-14 e166a beta-lactamase

PDB Compounds: (A:) CTX-M-14 Class A Beta-Lactamase

SCOPe Domain Sequences for d4xxra_:

Sequence; same for both SEQRES and ATOM records:

>d4xxra_ e.3.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
tsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqset
qkqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggpg
gvtafaraigdetfrldrtaptlntaipgdprdtttpramaqtlrqltlghalgetqraq
lvtwlkgnttgaasiraglptswtvgdktgsgdygttndiaviwpqgraplvlvtyftqp
qqnaesrrdvlasaariiaegl

Timeline for d4xxra_:

• d4xxra_ first appeared in SCOPe 2.05
  
• d4xxra_ appears in SCOPe 2.06
  
• d4xxra_ appears in the current release, SCOPe 2.08