Lineage for d4xvch1 (4xvc H:2-297)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (131 species)
    not a true protein
  7. 2902097Species Environmental samples [TaxId:33858] [270859] (1 PDB entry)
  8. 2902105Domain d4xvch1: 4xvc H:2-297 [270867]
    Other proteins in same PDB: d4xvca2, d4xvcb2, d4xvcc2, d4xvcd2, d4xvce2, d4xvcf2, d4xvcg2, d4xvch2
    automated match to d3g9ta_
    complexed with pms

Details for d4xvch1

PDB Entry: 4xvc (more details), 2 Å

PDB Description: crystal structure of an esterase from the bacterial hormone-sensitive lipase (hsl) family
PDB Compounds: (H:) Esterase E40

SCOPe Domain Sequences for d4xvch1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xvch1 c.69.1.0 (H:2-297) automated matches {Environmental samples [TaxId: 33858]}
akspeldrvigmireraatprkttdddrrlyetmlgsmpldddiqterlgvngvpaewiy
apgarddqvflylhgggyvigsmrthrvmlshiaraagcrvlgldyrlapetpfpapved
tvaayrwllahgydpsrialggdsaggglvvaalvalryigeplpaagvclspwidmeat
gesfttnatmdpsvnkervmsiaalylggknpqaplasplyadlqglppllvqvggietl
lddaralttrakaagvdadlevwddmphvwqhfapilpegkqaiarigeflrkqig

SCOPe Domain Coordinates for d4xvch1:

Click to download the PDB-style file with coordinates for d4xvch1.
(The format of our PDB-style files is described here.)

Timeline for d4xvch1: