![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
![]() | Protein automated matches [190543] (131 species) not a true protein |
![]() | Species Environmental samples [TaxId:33858] [270859] (1 PDB entry) |
![]() | Domain d4xvch1: 4xvc H:2-297 [270867] Other proteins in same PDB: d4xvca2, d4xvcb2, d4xvcc2, d4xvcd2, d4xvce2, d4xvcf2, d4xvcg2, d4xvch2 automated match to d3g9ta_ complexed with pms |
PDB Entry: 4xvc (more details), 2 Å
SCOPe Domain Sequences for d4xvch1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xvch1 c.69.1.0 (H:2-297) automated matches {Environmental samples [TaxId: 33858]} akspeldrvigmireraatprkttdddrrlyetmlgsmpldddiqterlgvngvpaewiy apgarddqvflylhgggyvigsmrthrvmlshiaraagcrvlgldyrlapetpfpapved tvaayrwllahgydpsrialggdsaggglvvaalvalryigeplpaagvclspwidmeat gesfttnatmdpsvnkervmsiaalylggknpqaplasplyadlqglppllvqvggietl lddaralttrakaagvdadlevwddmphvwqhfapilpegkqaiarigeflrkqig
Timeline for d4xvch1: