SCOPe 2.08: Domain d4xvch1: 4xvc H:2-297

Lineage for d4xvch1 (4xvc H:2-297)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (131 species)
   not a true protein

7. Species Environmental samples [TaxId:33858] [270859] (1 PDB entry)

8. Domain d4xvch1: 4xvc H:2-297 [270867]
   Other proteins in same PDB: d4xvca2, d4xvcb2, d4xvcc2, d4xvcd2, d4xvce2, d4xvcf2, d4xvcg2, d4xvch2
   automated match to d3g9ta_
   complexed with pms

Details for d4xvch1

PDB Entry: 4xvc, 2 Å

PDB Description: crystal structure of an esterase from the bacterial hormone-sensitive lipase (hsl) family

PDB Compounds: (H:) Esterase E40

SCOPe Domain Sequences for d4xvch1:

Sequence; same for both SEQRES and ATOM records:

>d4xvch1 c.69.1.0 (H:2-297) automated matches {Environmental samples [TaxId: 33858]}
akspeldrvigmireraatprkttdddrrlyetmlgsmpldddiqterlgvngvpaewiy
apgarddqvflylhgggyvigsmrthrvmlshiaraagcrvlgldyrlapetpfpapved
tvaayrwllahgydpsrialggdsaggglvvaalvalryigeplpaagvclspwidmeat
gesfttnatmdpsvnkervmsiaalylggknpqaplasplyadlqglppllvqvggietl
lddaralttrakaagvdadlevwddmphvwqhfapilpegkqaiarigeflrkqig

Timeline for d4xvch1:

• d4xvch1 first appeared in SCOPe 2.05, called d4xvch_
  
• d4xvch1 appears in SCOPe 2.07