Lineage for d4xrva_ (4xrv A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143226Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2143333Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2143580Family c.92.2.0: automated matches [191548] (1 protein)
    not a true family
  6. 2143581Protein automated matches [190944] (35 species)
    not a true protein
  7. 2143620Species Paracoccus denitrificans [TaxId:318586] [270856] (4 PDB entries)
  8. 2143621Domain d4xrva_: 4xrv A: [270857]
    automated match to d3hh8a_
    complexed with zn

Details for d4xrva_

PDB Entry: 4xrv (more details), 2.72 Å

PDB Description: structure of a zn abc transporter substrate binding protein from paracoccus denitrificans
PDB Compounds: (A:) Periplasmic solute binding protein

SCOPe Domain Sequences for d4xrva_:

Sequence, based on SEQRES records: (download)

>d4xrva_ c.92.2.0 (A:) automated matches {Paracoccus denitrificans [TaxId: 318586]}
pldvvatfsiigdfaakvggdrirlnvlvgpdsdthvyeprpadaialagadvvltngle
fegfltrliaasgtdaavatltdgvetmeepggghyhyidgkavfhagahdphawqavpn
akvyvqniaaafcaadaegcaayqanaaryigeldaldteiraaiaalpqdrrtvvvahn
afryfeaaygvhflspqgvsteseaaaadvaglireirarnasaifaenisdtrlleqia
reaglplagtlysdalsgpdgpasnyiammrhnagaiaaala

Sequence, based on observed residues (ATOM records): (download)

>d4xrva_ c.92.2.0 (A:) automated matches {Paracoccus denitrificans [TaxId: 318586]}
pldvvatfsiigdfaakvggdrirlnvlvgpdsdthvyeprpadaialagadvvltngle
fegfltrliaasgtdaavatltdgvetmeehdphawqavpnakvyvqniaaafcaadaeg
caayqanaaryigeldaldteiraaiaalpqdrrtvvvahnafryfeaaygvhflspqgv
stvaglireirarnasaifaenisdtrlleqiareaglplagtlysdalsgpdgpasnyi
ammrhnagaiaaala

SCOPe Domain Coordinates for d4xrva_:

Click to download the PDB-style file with coordinates for d4xrva_.
(The format of our PDB-style files is described here.)

Timeline for d4xrva_: