SCOPe 2.06: Domain d4xkfb_: 4xkf B:

Lineage for d4xkfb_ (4xkf B:)

1. Root: SCOPe 2.06

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein Influenza hemagglutinin (stalk) [58066] (12 species)
   trimer

7. Species Influenza A virus, different strains [TaxId:11320] [58067] (127 PDB entries)

8. Domain d4xkfb_: 4xkf B: [270855]
   Other proteins in same PDB: d4xkfa_, d4xkfc_, d4xkfe_
   automated match to d4h32b_
   complexed with gal, nag, sia

Details for d4xkfb_

PDB Entry: 4xkf, 2.45 Å

PDB Description: crystal structure of hemagglutinin from taiwan (2013) h6n1 influenza virus in complex with lsta

PDB Compounds: (B:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d4xkfb_:

Sequence; same for both SEQRES and ATOM records:

>d4xkfb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkesklnrqgi

Timeline for d4xkfb_:

• d4xkfb_ first appeared in SCOPe 2.05
  
• d4xkfb_ appears in SCOPe 2.07
  
• d4xkfb_ appears in the current release, SCOPe 2.08