SCOPe 2.07: Domain d4x7sl2: 4x7s L:111-218

Lineage for d4x7sl2 (4x7s L:111-218)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (151 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody

8. Domain d4x7sl2: 4x7s L:111-218 [270851]
   Other proteins in same PDB: d4x7sl1
   automated match to d1dn0a2

Details for d4x7sl2

PDB Entry: 4x7s, 1.9 Å

PDB Description: structure of omalizumab fab fragment crystal form 1

PDB Compounds: (L:) Ig kappa chain C region

SCOPe Domain Sequences for d4x7sl2:

Sequence; same for both SEQRES and ATOM records:

>d4x7sl2 b.1.1.2 (L:111-218) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

Timeline for d4x7sl2:

• d4x7sl2 first appeared in SCOPe 2.05
  
• d4x7sl2 appears in SCOPe 2.06
  
• d4x7sl2 appears in the current release, SCOPe 2.08