Lineage for d4xkfd_ (4xkf D:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3040827Protein Influenza hemagglutinin (stalk) [58066] (22 species)
    trimer
  7. 3041028Species Influenza A virus, different strains [TaxId:11320] [58067] (150 PDB entries)
  8. 3041113Domain d4xkfd_: 4xkf D: [270849]
    Other proteins in same PDB: d4xkfa_, d4xkfc_, d4xkfe_
    automated match to d4h32b_
    complexed with nag

Details for d4xkfd_

PDB Entry: 4xkf (more details), 2.45 Å

PDB Description: crystal structure of hemagglutinin from taiwan (2013) h6n1 influenza virus in complex with lsta
PDB Compounds: (D:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d4xkfd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xkfd_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkesklnrqgi

SCOPe Domain Coordinates for d4xkfd_:

Click to download the PDB-style file with coordinates for d4xkfd_.
(The format of our PDB-style files is described here.)

Timeline for d4xkfd_: