| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
| Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
| Protein Influenza hemagglutinin (stalk) [58066] (22 species) trimer |
| Species Influenza A virus, different strains [TaxId:11320] [58067] (150 PDB entries) |
| Domain d4xkfd_: 4xkf D: [270849] Other proteins in same PDB: d4xkfa_, d4xkfc_, d4xkfe_ automated match to d4h32b_ complexed with nag |
PDB Entry: 4xkf (more details), 2.45 Å
SCOPe Domain Sequences for d4xkfd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xkfd_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkesklnrqgi
Timeline for d4xkfd_: