SCOPe 2.08: Domain d4x7tl2: 4x7t L:111-218

Lineage for d4x7tl2 (4x7t L:111-218)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d4x7tl2: 4x7t L:111-218 [270844]
   Other proteins in same PDB: d4x7ta_, d4x7tb1, d4x7th_, d4x7tl1
   automated match to d1dn0a2
   complexed with so4

Details for d4x7tl2

PDB Entry: 4x7t, 3 Å

PDB Description: structure of omalizumab fab fragment, crystal form 2

PDB Compounds: (L:) Omalizumab-Fab Light chain

SCOPe Domain Sequences for d4x7tl2:

Sequence; same for both SEQRES and ATOM records:

>d4x7tl2 b.1.1.2 (L:111-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

Timeline for d4x7tl2:

• d4x7tl2 first appeared in SCOPe 2.05
  
• d4x7tl2 appears in SCOPe 2.07