SCOPe 2.08: Domain d4x7tl1: 4x7t L:1-110

Lineage for d4x7tl1 (4x7t L:1-110)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4x7tl1: 4x7t L:1-110 [270843]
   Other proteins in same PDB: d4x7ta_, d4x7tb2, d4x7th_, d4x7tl2
   automated match to d1dn0a1
   complexed with so4

Details for d4x7tl1

PDB Entry: 4x7t, 3 Å

PDB Description: structure of omalizumab fab fragment, crystal form 2

PDB Compounds: (L:) Omalizumab-Fab Light chain

SCOPe Domain Sequences for d4x7tl1:

Sequence; same for both SEQRES and ATOM records:

>d4x7tl1 b.1.1.0 (L:1-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqltqspsslsasvgdrvtitcrasqsvdydgdsymnwyqqkpgkapklliyaasyles
gvpsrfsgsgsgtdftltisslqpedfatyycqqshedpytfgqgtkvei

Timeline for d4x7tl1:

• d4x7tl1 first appeared in SCOPe 2.05
  
• d4x7tl1 appears in SCOPe 2.07